PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G2438
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 398aa    MW: 43765 Da    PI: 6.4281
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G2438genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.7e-175398147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd +l ++v ++G ++W++Iar +  gR++k+c++rw + 
      Gh_A09G2438 53 KGPWSPEEDAILSELVSKFGARNWSLIARGIA-GRSGKSCRLRWCNQ 98
                     79******************************.***********985 PP

2Myb_DNA-binding53.45.7e-17105149147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T eEd  ++ a++ +G++ W+ Iar ++ gRt++ +k++w++ 
      Gh_A09G2438 105 RKPFTDEEDRMIISAHAVHGNK-WAVIARLLP-GRTDNAIKNHWNST 149
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.348103IPR017930Myb domain
SuperFamilySSF466896.47E-3151146IPR009057Homeodomain-like
SMARTSM007172.5E-1552101IPR001005SANT/Myb domain
PfamPF002492.3E-165398IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-2654106IPR009057Homeodomain-like
CDDcd001671.86E-145597No hitNo description
PROSITE profilePS5129421.731104154IPR017930Myb domain
SMARTSM007171.5E-16104152IPR001005SANT/Myb domain
PfamPF002491.1E-14105149IPR001005SANT/Myb domain
CDDcd001671.45E-12107150No hitNo description
Gene3DG3DSA:1.10.10.605.4E-24107153IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
METEVEAVDN GNGTTVAEIN VPSPPPLDGG EGGDCGSRDD SAVGGRARKQ RVKGPWSPEE  60
DAILSELVSK FGARNWSLIA RGIAGRSGKS CRLRWCNQLD PAVKRKPFTD EEDRMIISAH  120
AVHGNKWAVI ARLLPGRTDN AIKNHWNSTL RRRYMDLGRI NTESANMMED AGCLDKTKAS  180
SEETLSCAED SSFRSLEWKD ASSSEKLDNQ SKGKALTGTQ SDHELIEPPT LFRPVARIRA  240
FNVYNNMDAP EFVSPRSRSV PVLGPSIQTS KPDVGTCKLL ERVYTDRLVP LHCGHGCCGT  300
QNGQNKSLLG PEFVEFSEPP SFPNYELAAI ATDISNLAWL KSGLENNSVR AMDDATAGTS  360
HRSQVHMGHF EESQMSDRLR IEERNSKFMG TMTNLLST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-40521536107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.198100.0boll| ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012486187.10.0PREDICTED: myb-related protein B-like
TrEMBLA0A0B0MUT00.0A0A0B0MUT0_G
STRINGVIT_08s0007g01540.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84922636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.11e-108myb domain protein 1